Immunological Data Discovery Index
Advanced Search
Displaying 20 of 1,509,085 results for " "
i
  1. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB

    ID: 1435459

    Description: epitope description:DKIDWRESGYVTELKDQGNC antigen name:Cathepsin host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;
  2. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB

    ID: 1435467

    Description: epitope description:DKIDWRESGYVTELKDQGNC antigen name:Cathepsin host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;
  3. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB

    ID: 1435470

    Description: epitope description:DKIDWRESGYVTELKDQGNC antigen name:Cathepsin host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;
  4. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB

    ID: 1435473

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;
  5. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB

    ID: 1435474

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;
  6. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB

    ID: 1435478

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;
  7. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB

    ID: 1435485

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;
  8. Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB

    ID: 1435489

    Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera

    Publication: 16168617;
  9. Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein. IEDB

    ID: 1435504

    Description: epitope description:SNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/...

    Publication: 7506298;
  10. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB

    ID: 1435518

    Description: epitope description:VLLRRIGG host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera

    Publication: 11122460;
  11. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB

    ID: 1435522

    Description: epitope description:VLLRRIGG host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera

    Publication: 11122460;
  12. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB

    ID: 1435535

    Description: epitope description:HLLRLSEI host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera

    Publication: 11122460;
  13. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB

    ID: 1435537

    Description: epitope description:HLLRLSEI host organism:Mus musculus DBA/2 antibody name:152-66-9B

    Publication: 11122460;
  14. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB

    ID: 1435540

    Description: epitope description:SLLTYMKM host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera

    Publication: 11122460;
  15. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB

    ID: 1435545

    Description: epitope description:YLLQKLRN host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera

    Publication: 11122460;
  16. A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB

    ID: 1435549

    Description: epitope description:YLLQKLRN host organism:Mus musculus CD1 antibody name:Infected mouse sera

    Publication: 11122460;
  17. Peptide mimotopes selected from a random peptide library for diagnosis of Epstein-Barr virus infection. IEDB

    ID: 1435551

    Description: epitope description:GGWYSFDSPYLMSITEMRLR host organism:Mus musculus antibody name:L2

    Publication: 16517852;
  18. Peptide mimotopes selected from a random peptide library for diagnosis of Epstein-Barr virus infection. IEDB

    ID: 1435558

    Description: epitope description:GGWYSFDSPYLMSITEMRLR host organism:Homo sapiens

    Publication: 16517852;
  19. Characterization of the Borna disease virus phosphoprotein, p23. IEDB

    ID: 1435575

    Description: epitope description:PSSLVDSL antigen name:Phosphoprotein host organism:Rattus norvegicus

    Publication: 8892940;
  20. Characterization of the Borna disease virus phosphoprotein, p23. IEDB

    ID: 1435588

    Description: epitope description:PMLPSHPA antigen name:Phosphoprotein host organism:Rattus norvegicus

    Publication: 8892940;

Displaying 20 of 1,509,085 results for " "