Immunological Data Discovery Index
Advanced Search
Displaying 20 of 1,509,085 results for " "
i
  1. Characterization of the nucleocapsid protein of Hantaan virus strain 76-118 using monoclonal antibodies. IEDB

    ID: 1459184

    Description: epitope description:EDVNGIRKPK antigen name:Hantaan orthohantavirus protein host organism:Mus musculus BALB/c antibody name:MAb E5/G6

    Publication: 8627258;
  2. Characterization of the nucleocapsid protein of Hantaan virus strain 76-118 using monoclonal antibodies. IEDB

    ID: 1459189

    Description: epitope description:EDVNGIRKPK antigen name:Hantaan orthohantavirus protein host organism:Mus musculus BALB/c antibody name:MAb E5/G6

    Publication: 8627258;
  3. Characterization of B cell epitopes on the 16K antigen of Mycobacterium tuberculosis. IEDB

    ID: 1459481

    Description: epitope description:PRSLFPEFSELFAAFPSFAG antigen name:Alpha-crystallin host organism:Homo sapiens

    Publication: 1381300;
  4. Characterization of B cell epitopes on the 16K antigen of Mycobacterium tuberculosis. IEDB

    ID: 1459483

    Description: epitope description:DPDKDVDIMVRDGQLTIKAE antigen name:Alpha-crystallin host organism:Homo sapiens

    Publication: 1381300;
  5. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus. IEDB

    ID: 1459492

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Bos taurus antibody name:Cattle sera

    Publication: 2157884;
  6. Implications of antibodies to pyruvylated glucose in healthy populations for mycobacterioses and other infectious diseases. IEDB

    ID: 1459524

    Description: epitope description:4,6-(1'-carboxyethylidene)-3-O-methyl-beta-D-glucopyranose antigen name:GPL-8 host organism:Homo sapiens

    Publication: 2332469;
  7. Implications of antibodies to pyruvylated glucose in healthy populations for mycobacterioses and other infectious diseases. IEDB

    ID: 1459525

    Description: epitope description:4,6-(1'-carboxyethylidene)-3-O-methyl-beta-D-glucopyranose antigen name:GPL-8 host organism:Homo sapiens

    Publication: 2332469;
  8. Vaccination against gonorrhoea: the potential protective effect of immunization with a synthetic peptide containing a conserved epitope of gonococcal ... IEDB

    ID: 1459543

    Description: epitope description:DDQTYSIPSLFV antigen name:Membrane protein (UniProt:Q5F5V7) host organism:Oryctolagus cuniculus

    Publication: 1694611;
  9. Protection against P. aeruginosa with an adenovirus vector containing an OprF epitope in the capsid. IEDB

    ID: 1459585

    Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus C57BL/6 antibody name:Mouse serum

    Publication: 15841217;
  10. Protection against P. aeruginosa with an adenovirus vector containing an OprF epitope in the capsid. IEDB

    ID: 1459587

    Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus C57BL/6 antibody name:Mouse serum

    Publication: 15841217;
  11. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB

    ID: 1459603

    Description: epitope description:NVSAIFMAVLLTLQT antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  12. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB

    ID: 1459608

    Description: epitope description:SKIGVVGIGSASYKV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  13. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB

    ID: 1459609

    Description: epitope description:VGIGSASYKVMTRSS antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  14. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB

    ID: 1459622

    Description: epitope description:VQSVASSRRHKRFAG antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  15. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB

    ID: 1459624

    Description: epitope description:KRFAGVVLAGAALGV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  16. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB

    ID: 1459634

    Description: epitope description:IEAIRQAGQEMILAV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  17. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB

    ID: 1459635

    Description: epitope description:QAGQEMILAVQGVQD antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  18. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB

    ID: 1459639

    Description: epitope description:LIPSMNQLSCDLIGQ antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  19. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB

    ID: 1459649

    Description: epitope description:YALGGDINKVLEKLG antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;
  20. Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB

    ID: 1459655

    Description: epitope description:KARITHVDTESYFIV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera

    Publication: 1383402;

Displaying 20 of 1,509,085 results for " "