Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB
ID: 1435459
Description: epitope description:DKIDWRESGYVTELKDQGNC antigen name:Cathepsin host organism:Homo sapiens antibody name:Human sera
Publication: 16168617;Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB
ID: 1435467
Description: epitope description:DKIDWRESGYVTELKDQGNC antigen name:Cathepsin host organism:Homo sapiens antibody name:Human sera
Publication: 16168617;Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB
ID: 1435470
Description: epitope description:DKIDWRESGYVTELKDQGNC antigen name:Cathepsin host organism:Homo sapiens antibody name:Human sera
Publication: 16168617;Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB
ID: 1435473
Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera
Publication: 16168617;Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB
ID: 1435474
Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera
Publication: 16168617;Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB
ID: 1435478
Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera
Publication: 16168617;Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB
ID: 1435485
Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera
Publication: 16168617;Potent epitopes derived from Fasciola gigantica cathepsin L1 in peptide-based immunoassay for the serodiagnosis of human fascioliasis. IEDB
ID: 1435489
Description: epitope description:DKIDWRESGYVTEVKDQGNC antigen name:Cathepsin L (UniProt:Q9NGW1) host organism:Homo sapiens antibody name:Human sera
Publication: 16168617;Conformational constraints of conserved neutralizing epitopes from a major antigenic area of human respiratory syncytial virus fusion glycoprotein. IEDB
ID: 1435504
Description: epitope description:SNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMS antigen name:Fusion glycoprotein F0 host organism:Mus musculus BALB/...
Publication: 7506298;A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB
ID: 1435518
Description: epitope description:VLLRRIGG host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera
Publication: 11122460;A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB
ID: 1435522
Description: epitope description:VLLRRIGG host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera
Publication: 11122460;A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB
ID: 1435535
Description: epitope description:HLLRLSEI host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera
Publication: 11122460;A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB
ID: 1435537
Description: epitope description:HLLRLSEI host organism:Mus musculus DBA/2 antibody name:152-66-9B
Publication: 11122460;A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB
ID: 1435540
Description: epitope description:SLLTYMKM host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera
Publication: 11122460;A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB
ID: 1435545
Description: epitope description:YLLQKLRN host organism:Mus musculus C57BL/6 antibody name:Antipeptide sera
Publication: 11122460;A mimotope peptide-based vaccine against Schistosoma mansoni: synthesis and characterization. IEDB
ID: 1435549
Description: epitope description:YLLQKLRN host organism:Mus musculus CD1 antibody name:Infected mouse sera
Publication: 11122460;Peptide mimotopes selected from a random peptide library for diagnosis of Epstein-Barr virus infection. IEDB
ID: 1435551
Description: epitope description:GGWYSFDSPYLMSITEMRLR host organism:Mus musculus antibody name:L2
Publication: 16517852;Peptide mimotopes selected from a random peptide library for diagnosis of Epstein-Barr virus infection. IEDB
ID: 1435558
Description: epitope description:GGWYSFDSPYLMSITEMRLR host organism:Homo sapiens
Publication: 16517852;Characterization of the Borna disease virus phosphoprotein, p23. IEDB
ID: 1435575
Description: epitope description:PSSLVDSL antigen name:Phosphoprotein host organism:Rattus norvegicus
Publication: 8892940;Characterization of the Borna disease virus phosphoprotein, p23. IEDB
ID: 1435588
Description: epitope description:PMLPSHPA antigen name:Phosphoprotein host organism:Rattus norvegicus
Publication: 8892940;