Immunological Data Discovery Index
Advanced Search
  2. Knowledge
Displaying 20 of 1,509,085 results for " "
i

  1. Peptide mimotopes selected from a random peptide library for diagnosis of Epstein-Barr virus infection. IEDB

    ID: 1435606

    Description: epitope description:YTDSSMAVTLMKFASNFLF host organism:Mus musculus antibody name:F1

    Publication: 16517852;

  2. Peptide mimotopes selected from a random peptide library for diagnosis of Epstein-Barr virus infection. IEDB

    ID: 1435660

    Description: epitope description:SKLLYNYGACRTGCYMAGR host organism:Mus musculus antibody name:A3

    Publication: 16517852;

  3. Peptide mimotopes selected from a random peptide library for diagnosis of Epstein-Barr virus infection. IEDB

    ID: 1435665

    Description: epitope description:VMDECVFSSISVLFCNHMLH host organism:Mus musculus antibody name:A3

    Publication: 16517852;

  4. Species-, serogroup-, and serovar-specific epitopes are juxtaposed in variable sequence region 4 of the major outer membrane proteins of some Chlamydi... IEDB

    ID: 1435681

    Description: epitope description:FPLDLT antigen name:Major outer membrane porin host organism:Mus musculus antibody name:F22/4C11, F2/3G8

    Publication: 8698520;

  5. Synthesis and characterization of a protective peptide-based vaccine against Schistosoma mansoni. IEDB

    ID: 1435769

    Description: epitope description:GFTTNEPRYNVFAE antigen name:Other Schistosoma mansoni protein host organism:Mus musculus C57BL/6 antibody name:Mouse sera

    Publication: 9712813;

  6. Synthesis and characterization of a protective peptide-based vaccine against Schistosoma mansoni. IEDB

    ID: 1435775

    Description: epitope description:GFTTNEPRYNVFAE antigen name:Other Schistosoma mansoni protein host organism:Mus musculus C57BL/6 antibody name:Mouse sera

    Publication: 9712813;

  7. Probing immunogenicity of a T cell epitope by L-alanine and D-amino acid scanning. IEDB

    ID: 1436038

    Description: epitope description:CYKKAWRDHRGTI + D-aa(A5) host organism:Mus musculus BALB/c

    Publication: 8544857;

  8. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera. IEDB

    ID: 1436145

    Description: epitope description:TLDTAH host organism:Equus caballus

    Publication: 10921846;

  9. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera. IEDB

    ID: 1436153

    Description: epitope description:KQSRRG host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  10. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera. IEDB

    ID: 1436155

    Description: epitope description:HLFEAP host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  11. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera. IEDB

    ID: 1436160

    Description: epitope description:PRLKHEQSV host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  12. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera. IEDB

    ID: 1436163

    Description: epitope description:HRGRAQ host organism:Equus caballus

    Publication: 10921846;

  13. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera. IEDB

    ID: 1436166

    Description: epitope description:FTILRY host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  14. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera. IEDB

    ID: 1436171

    Description: epitope description:TSMARYVRHSNYKHM host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  15. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera. IEDB

    ID: 1436172

    Description: epitope description:MSPILDFPSRKTMKT host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  16. Utilisation of bacteriophage display libraries to identify peptide sequences recognised by equine herpesvirus type 1 specific equine sera. IEDB

    ID: 1436174

    Description: epitope description:SCNDNKSVPCIVPQL host organism:Equus caballus antibody name:F19

    Publication: 10921846;

  17. Serological specificity of phenolic glycolipid I from Mycobacterium leprae and use in serodiagnosis of leprosy. IEDB

    ID: 1436190

    Description: epitope description:phenolic phthiocerol antigen name:phenolic glycolipid-1 host organism:Oryctolagus cuniculus

    Publication: 6193065;

  18. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus. IEDB

    ID: 1436196

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;

  19. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus. IEDB

    ID: 1436205

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;

  20. Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus. IEDB

    ID: 1436206

    Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Cavia porcellus antibody name:Guinea pig sera

    Publication: 2157884;
Displaying 20 of 1,509,085 results for " "

ImmuneData is supported by the NIAID, Grant HHSN272201700019C. Privacy

ImmuneData is developed by TechWave International, Inc. and UT Health Science Center at Houston