Characterization of the nucleocapsid protein of Hantaan virus strain 76-118 using monoclonal antibodies. IEDB
ID: 1459184
Description: epitope description:EDVNGIRKPK antigen name:Hantaan orthohantavirus protein host organism:Mus musculus BALB/c antibody name:MAb E5/G6
Publication: 8627258;Characterization of the nucleocapsid protein of Hantaan virus strain 76-118 using monoclonal antibodies. IEDB
ID: 1459189
Description: epitope description:EDVNGIRKPK antigen name:Hantaan orthohantavirus protein host organism:Mus musculus BALB/c antibody name:MAb E5/G6
Publication: 8627258;Characterization of B cell epitopes on the 16K antigen of Mycobacterium tuberculosis. IEDB
ID: 1459481
Description: epitope description:PRSLFPEFSELFAAFPSFAG antigen name:Alpha-crystallin host organism:Homo sapiens
Publication: 1381300;Characterization of B cell epitopes on the 16K antigen of Mycobacterium tuberculosis. IEDB
ID: 1459483
Description: epitope description:DPDKDVDIMVRDGQLTIKAE antigen name:Alpha-crystallin host organism:Homo sapiens
Publication: 1381300;Heterotypic protection induced by synthetic peptides corresponding to three serotypes of foot-and-mouth disease virus. IEDB
ID: 1459492
Description: epitope description:CCRHKQKIIAPAKQLLPPSGSGRRGDMGSLAARVVKQPCG host organism:Bos taurus antibody name:Cattle sera
Publication: 2157884;Implications of antibodies to pyruvylated glucose in healthy populations for mycobacterioses and other infectious diseases. IEDB
ID: 1459524
Description: epitope description:4,6-(1'-carboxyethylidene)-3-O-methyl-beta-D-glucopyranose antigen name:GPL-8 host organism:Homo sapiens
Publication: 2332469;Implications of antibodies to pyruvylated glucose in healthy populations for mycobacterioses and other infectious diseases. IEDB
ID: 1459525
Description: epitope description:4,6-(1'-carboxyethylidene)-3-O-methyl-beta-D-glucopyranose antigen name:GPL-8 host organism:Homo sapiens
Publication: 2332469;Vaccination against gonorrhoea: the potential protective effect of immunization with a synthetic peptide containing a conserved epitope of gonococcal ... IEDB
ID: 1459543
Description: epitope description:DDQTYSIPSLFV antigen name:Membrane protein (UniProt:Q5F5V7) host organism:Oryctolagus cuniculus
Publication: 1694611;Protection against P. aeruginosa with an adenovirus vector containing an OprF epitope in the capsid. IEDB
ID: 1459585
Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus C57BL/6 antibody name:Mouse serum
Publication: 15841217;Protection against P. aeruginosa with an adenovirus vector containing an OprF epitope in the capsid. IEDB
ID: 1459587
Description: epitope description:NATAEGRAINRRVE antigen name:Outer membrane porin F host organism:Mus musculus C57BL/6 antibody name:Mouse serum
Publication: 15841217;Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB
ID: 1459603
Description: epitope description:NVSAIFMAVLLTLQT antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera
Publication: 1383402;Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB
ID: 1459608
Description: epitope description:SKIGVVGIGSASYKV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera
Publication: 1383402;Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB
ID: 1459609
Description: epitope description:VGIGSASYKVMTRSS antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera
Publication: 1383402;Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB
ID: 1459622
Description: epitope description:VQSVASSRRHKRFAG antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera
Publication: 1383402;Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB
ID: 1459624
Description: epitope description:KRFAGVVLAGAALGV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera
Publication: 1383402;Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB
ID: 1459634
Description: epitope description:IEAIRQAGQEMILAV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera
Publication: 1383402;Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB
ID: 1459635
Description: epitope description:QAGQEMILAVQGVQD antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera
Publication: 1383402;Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB
ID: 1459639
Description: epitope description:LIPSMNQLSCDLIGQ antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera
Publication: 1383402;Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB
ID: 1459649
Description: epitope description:YALGGDINKVLEKLG antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera
Publication: 1383402;Heterogeneity of linear B cell epitopes of the measles virus fusion protein reacting with late convalescent sera. IEDB
ID: 1459655
Description: epitope description:KARITHVDTESYFIV antigen name:Fusion glycoprotein F0 host organism:Homo sapiens antibody name:Human sera
Publication: 1383402;