Localization of linear B-cell epitopes on infectious bronchitis virus nucleocapsid protein. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

Localization of linear B-cell epitopes on infectious bronchitis virus nucleocapsid protein.

Dataset

identifier:	1466523
description:	epitope description:DGRVTAMLNLVPSSHACLFGSRVTPKLQLDGLH antigen name:Nucleoprotein host organism:Gallus gallus
aggregation:	instance of dataset
availability:	available
primaryPublications:	10865148

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1006766
landingPage:	http://www.iedb.org/assay/1466523

Publication

type:	Literature
publicationVenue:	Vet Microbiol
dates:	2000

Dimension

study type:	b cell assays
subject species:	Avian infectious bronchitis virus (strain M41)

Person

fullName:	J N Seah L Yu J Kwang

Data Type

method:	western blot

Study

name:	Localization of linear B-cell epitopes on infectious bronchitis virus nucleocapsid protein.
description:	The peptide sequence is published in Boursnell, et al. J. Gen. Virol. 66 (Pt 3), 573-580 (1985) [PMID 2983001]. Negative reactivity was also found with antisera against Australia T, China Ch5, Singapore P4, and China T3 isolates of infectious bronchitis virus. Strong positive reactivity was found against fragments of the nucleocapsid protein spanning amino acids 175-209, 310-370, and 360-409.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.