Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia.

Dataset

identifier:	1465643
description:	epitope description:SVTFELLFDGTSPLTEEMGDDFGFGLCPYDTSPVVKGKYNTTLLNGSA antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:b12
aggregation:	instance of dataset
availability:	available
primaryPublications:	7691986

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1004790
landingPage:	http://www.iedb.org/assay/1465643

Publication

type:	Literature
publicationVenue:	J Gen Virol
dates:	1993

Dimension

study type:	b cell assays
subject species:	Classical swine fever virus - Brescia

Person

fullName:	P A van Rijn H G van Gennip E J de Meijer R J Moormann

Data Type

method:	ELISA

Study

name:	Epitope mapping of envelope glycoprotein E1 of hog cholera virus strain Brescia.
description:	The epitope-containing region was deduced following loss of mAb binding to E1 protein that was deleted of the epitope-containing region. The mAb stained positive on COS1 monolayers transfected with a plasmid for expression of full-length E1 protein of hog cholera virus strain Brescia.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.