Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

Title:

Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.

identifier:	1379122
description:	epitope description:GDRGILIHNTIFGEQVFLPLEHSQFSRYRWRGPTAAFLSLVDQKRSL antigen name:DNA polymerase processivity factor host organism:Mus musculus BALB/c antibody name:5
aggregation:	instance of dataset
availability:	available
primaryPublications:	8578868

study type:	b cell assays
subject species:	Herpes simplex virus (type 1 / strain 17)

fullName:	A K Sheaffer W W Hurlburt J T Stevens M Bifano R K Hamatake R J Colonno D J Tenney

method:	immunoprecipitation

name:	Characterization of monoclonal antibodies recognizing amino- and carboxy-terminal epitopes of the herpes simplex virus UL42 protein.
description:	This region cannot be considered to represent the complete epitope recognized based on the assays used for its identification. Immunoprecipitation of [³⁵S]methionine labeled truncated UL42 molecules was assessed with a monoclonal antibody, and this region was determined to be involved in the mAb reactivity.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.