Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

Title:

Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.

identifier:	1384352
description:	epitope description:CRFPNITNSHVPILQERPPLENRVLTGYGL host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	1955565

study type:	b cell assays
subject species:

fullName:	M Nakamura M Kuroki J Kira Y Itoyama H Shiraki N Kuroda Y Washitani S Nakano S Nagafuchi K Anzai et al.

method:	ELISA

name:	Elevated antibodies to synthetic peptides of HTLV-1 envelope transmembrane glycoproteins in patients with HAM/TSP.
description:	The authors synthesized this peptide based on the sequence of HTLV-1 env gene (Hoop and Woods (1981) PNAS 78: 3824-3828 Seiki et al (1983) PNAS 80:3618-3622 Kuroda et al (1990) Int J Cancer 45:865-868). The peptide differs at position 28 with a Trp for the Tyr following a BLAST search of GenBank.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.