Inducing tolerance by intranasal administration of long peptides in naive and primed CBA/J mice.

Title:

Inducing tolerance by intranasal administration of long peptides in naive and primed CBA/J mice.

identifier:	1409856
description:	epitope description:LIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY antigen name:Api m 1 host organism:Mus musculus CBA/J
aggregation:	instance of dataset
availability:	available
primaryPublications:	10975871

study type:	b cell assays
subject species:	Apis mellifera

fullName:	M Astori C von Garnier A Kettner N Dufour G Corradin F Spertini

method:	western blot

name:	Inducing tolerance by intranasal administration of long peptides in naive and primed CBA/J mice.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.