Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

Title:

Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.

identifier:	1415780
description:	epitope description:IPKVPPGPNITATYGDKWLDAKSTWYGKPTG antigen name:Phl p 1 host organism:Mus musculus BALB/c antibody name:anti-peptide 3
aggregation:	instance of dataset
availability:	available
primaryPublications:	11511525

study type:	b cell assays
subject species:	Phleum pratense

fullName:	M Focke V Mahler W R Sperr Y Majlesi P Valent D Kraft R Valenta

method:	ELISA

name:	Nonanaphylactic synthetic peptides derived from B cell epitopes of the major grass pollen allergen, Phl p 1, for allergy vaccination.
description:	All courses of immunization with the epitope alone or coupled to KLH induced IgG1 anti-Phl p 1 antibody responses in mice. The epitope was synthesized with a C-terminal Cys residue for coupling.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.