Hypoallergenic variants of the major latex allergen Hev b 6.01 retaining human T lymphocyte reactivity.

Title:

Hypoallergenic variants of the major latex allergen Hev b 6.01 retaining human T lymphocyte reactivity.

identifier:	1435173
description:	epitope description:EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD antigen name:Hev b 6 host organism:Mus musculus BALB/c antibody name:1A5.4
aggregation:	instance of dataset
availability:	available
primaryPublications:	15494541

study type:	b cell assays
subject species:	Hevea brasiliensis

fullName:	Alexander C Drew Nirupama P Eusebius Linda Kenins Harini D de Silva Cenk Suphioglu Jennifer M Rolland Robyn E O'hehir

method:	antigen inhibition

name:	Hypoallergenic variants of the major latex allergen Hev b 6.01 retaining human T lymphocyte reactivity.
description:	The epitope Hev b 6.02 (hevein) inhibited binding of mAb 1A5.4 to Hev b 6.01 (prohevein). This was in contrast to the lack of significant IgE binding observed in direct ELISA to the epitope.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.