Hypoallergenic variants of the major latex allergen Hev b 6.01 retaining human T lymphocyte reactivity.

Title:

Hypoallergenic variants of the major latex allergen Hev b 6.01 retaining human T lymphocyte reactivity.

identifier:	1435178
description:	epitope description:EQAGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD host organism:Homo sapiens antibody name:patient blood
aggregation:	instance of dataset
availability:	available
primaryPublications:	15494541

study type:	b cell assays
subject species:

fullName:	Alexander C Drew Nirupama P Eusebius Linda Kenins Harini D de Silva Cenk Suphioglu Jennifer M Rolland Robyn E O'hehir

method:	in vivo skin test

name:	Hypoallergenic variants of the major latex allergen Hev b 6.01 retaining human T lymphocyte reactivity.
description:	The sequence is an analog of Hev b 6.02 (hevein Swiss-Prot no. P02877) with a Cys to Ala substitution at position 3. The epitope activated basophils from 3 of 6 latex-allergic subjects as detected by expression of CD63 on high IgE staining cells. The epitope was not as effective as wild type Hev b 6.02 (hevein) in activating basophils from 5 of the 6 patients.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.