| identifier: | 1036 |
| description: |
epitope description:MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN
antigen name:C5a anaphylatoxin chemotactic receptor 1
host organism:Homo sapiens
antibody name:IgG-reformatted clones (multiple tested)
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
15706605 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/405 |
| landingPage: |
http://www.iedb.org/assay/1036 |
| type: |
Literature
|
| publicationVenue: |
J Mol Recognit
|
| dates: |
2005
|
| study type: | b cell assays |
| subject species: | Homo sapiens |
| fullName: |
Lili Huang
Aaron K Sato
Meena Sachdeva
Tony Fleming
Susan Townsend
Daniel T Dransfield
|
| method: |
flow cytometry
|
| name: |
Discovery of human antibodies against the C5aR target using phage display technology.
|
| description: |
Reformatted and humanized IgG clones were tested by FACS for their cell binding activities on C5aR-expressing cells. Binding of clones to undifferentiated U-397 cells was used as the control. Promonocytic U-937 cells were terminally differentiated with Bt2cAMP for 3 days prior to assay.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |