Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.

Title:

Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.

identifier:	15305
description:	epitope description:PSSKRFQPFQQFGRDVSDFTDSVRDPKTSE antigen name:Spike glycoprotein host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	15811330

study type:	b cell assays
subject species:	SARS coronavirus

fullName:	Wei Lu Xiao-Dong Wu Mu De Shi Rui Fu Yang You Yu He Chao Bian Tie Liu Shi Sheng Yang Xue-Liang Zhu Wei-Hong Jiang Yi Xue Li Lin-Chen Yan Yong Yong Ji Ying Lin Guo-Mei Lin Lin Tian Jin Wang Hong Xia Wang You Hua Xie Gang Pei Jia Rui Wu Bing Sun

method:	ELISA

name:	Synthetic peptides derived from SARS coronavirus S protein with diagnostic and therapeutic potential.
description:	S protein-specific IgG was purified from sera from SARS patients and a mixture containing IgG served as a template to determine its reaction with the peptide. The peptide showed higher immunoreactivity and higher specificity than the shorter peptide, PSSKRFQPFQQFGRDVSDFT, which was also studied. No response to healthy controls was observed.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.