Immunological Data Discovery Index
Immunological Data Discovery Index
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1000490 |
| landingPage: |
http://www.iedb.org/assay/1032289 |
| type: |
Literature
|
| publicationVenue: |
Proc Natl Acad Sci U S A
|
| dates: |
1997
|
| study type: | b cell assays |
| subject species: |
| fullName: |
S L Harris
L Craig
J S Mehroke
M Rashed
M B Zwick
K Kenar
E J Toone
N Greenspan
F I Auzanneau
J R Marino-Albernas
B M Pinto
J K Scott
|
| method: |
ELISA
|
| name: |
Exploring the basis of peptide-carbohydrate crossreactivity: evidence for discrimination by peptides between closely related anti-carbohydrate antibodies.
|
| description: |
Peptide selected from a random 6-mer library by an anti-carbohydrate antibody specific for the Group A Streptococcus cell-wall polysaccharide.
The phage displayed peptide is shown to be recognized by the mAb used for immunopanning, with a reactivity higher but similar than that towards other consensus-bearing (RPXXY) peptides. This mAb sequence is not deposit in current databases. Its VH region sequence is EVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMDWVRQSPEKGLEWVAEIRLKSNNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCIDLAWFAYWGQGTLVTVSA, its VL region sequence is DIVMTQAAFSNPVTLGTSASISCRSSKNLLHSNGITYLYWYLQRPGQSPQLLIYRVSNLASGVPNRFSGSESGTDFTLRISRVEAEDVGVYYCAQLLELPYTFGGGTKLEIK.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |
