| identifier: | 1212972 |
| description: |
epitope description:VEKNITVTASVDPVIDLLQADGNALPSAVKLAYSPASKTFESYRVM
antigen name:CFA/I fimbrial subunit B (UniProt:E3PPC4)
host organism:Mus musculus BALB/c
antibody name:MAb 65D, MAb 1:6
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
2460491 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1000647 |
| landingPage: |
http://www.iedb.org/assay/1212972 |
| type: |
Literature
|
| publicationVenue: |
J Clin Microbiol
|
| dates: |
1988
|
| study type: | b cell assays |
| subject species: | Escherichia coli ETEC H10407 |
| fullName: |
Y Lopez-Vidal
P Klemm
A M Svennerholm
|
| method: |
antigen inhibition
|
| name: |
Monoclonal antibodies against different epitopes on colonization factor antigen I of enterotoxin-producing Escherichia coli.
|
| description: |
The epitope was deduced by noting the capacity of the soluble peptide to inhbit binding of 2 monoclonal antibodies to solid-phase-bound colonizaion factor antigen I. This region contains 2 predicted antigenic sites.
The capacity of colonization factor antigen I to inhibit binding of the monoclonal antibodies to solid-phase-bound CFA/I was assayed by an ELISA inhibition method.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |