| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1000605 |
| landingPage: |
http://www.iedb.org/assay/1244049 |
| type: |
Literature
|
| publicationVenue: |
J Virol
|
| dates: |
1992
|
| study type: | b cell assays |
| subject species: | Dengue virus 2 |
| fullName: |
J T Roehrig
A J Johnson
A R Hunt
B J Beaty
J H Mathews
|
| method: |
ELISA
|
| name: |
Enhancement of the antibody response to flavivirus B-cell epitopes by using homologous or heterologous T-cell epitopes.
|
| description: |
The antigen (peptide 17 ITVNPIVTEKDSPVNIE) with and without the N-terminal cysteine gave similar results. In addition, the longer combination peptide of DEN 04 and DEN 17 (KKNMEGKVVLPENLEYTIVITVNPIVTEKDSPVNIE) was also used, and results were similar.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |