Immunological Data Discovery Index
Immunological Data Discovery Index
| identifier: | 1274837 |
| description: |
epitope description:RGYMYLKGPRGSVMTTNIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEKILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLVAS
antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9)
host organism:Homo sapiens
antibody name:3D12
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
11553596 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1001514 |
| landingPage: |
http://www.iedb.org/assay/1274837 |
| type: |
Literature
|
| publicationVenue: |
Infect Immun
|
| dates: |
2001
|
| study type: | b cell assays |
| subject species: | Clostridium botulinum |
| fullName: |
B P Mullaney
M G Pallavicini
J D Marks
|
| method: |
ELISA
|
| name: |
Epitope mapping of neutralizing botulinum neurotoxin A antibodies by phage display.
|
| description: |
This 133-aminoacid stretch is the minimal epitopic region that was recognized by a neutralyzing mAb from a phage library encoding fragments of the BoNT/A Heavy chain binding domain (HC).
A library of BoNT/A receptor binding domain (Hc) fragments was selected with a scFv molecule obtained from a human vaccinated with pentavalent toxoid. The scFv was expressed as a fusion with a Fc-IgG1 scaffold. Random-selected clones from the second round of panning were tested by ELISA. Sequencing of positive clones revealed a minimal shared region between residues 1131-1264 (which is the full length of the shorter fragment obtained). Further mapping using 15-mers was unproductive, implying a conformational epitope is included in this region. Nevertheless, the mAb is able to recognize the toxin in denaturalizing Western blot.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |
