| identifier: | 1276215 |
| description: |
epitope description:MTWPVKDFNYSDPVNDNDILYLRIPQNKLITTPVKAFMITQNIWVIPERFSSDTNPSLSKPPRPTSKYQSYYDPSYLSTDEQKDTFLKGIIKLFKRINERDIGKKLINYLVVGSPFMGDSSTPEDTFDFTRHTTNIAVEKFENGSWKVTNIITPSVLIFGPLPNILDYTASLTLQGQQSNPSFEGFGTLSILKVAPEFLLTFSDVTSNQSSAVLGKSIFCMDPVIALMHELTHSLHQLYGINIPSDKRIRPQVSEGFFSQDGPNVQFEELYTFGGLDVEIIPQIERSQLREKALGHYKDIAKRLNNINKTIPSSWISNIDKYKKIFSEKYNFDKDNTGNFVVNIDKFNSLYSDLTNVMSEVVYSSQYNVKNRTHYFSRHYLPVFANILDDNIYTIRDGFNLTNKGFNIENSGQNIERNPALQKLSSESVVDLFTKVCLRLTK
antigen name:Botulinum neurotoxin type D, BoNT/D
host organism:Mus musculus BALB/c
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
6198281 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1001578 |
| landingPage: |
http://www.iedb.org/assay/1276215 |
| type: |
Literature
|
| publicationVenue: |
Infect Immun
|
| dates: |
1984
|
| study type: | b cell assays |
| subject species: | Clostridium botulinum D |
| fullName: |
K Oguma
S Murayama
B Syuto
H Iida
S Kubo
|
| method: |
ELISA
|
| name: |
Analysis of antigenicity of Clostridium botulinum type C1 and D toxins by polyclonal and monoclonal antibodies.
|
| description: |
This region is conserved in the Type D strains used in this study (SA and 1873) except for the following variations: residues 15-16 ND->PV in strain D-SA, residues 17-18 ND -> LQ in strain D-1873.
Out of 28 monoclonal antibodies obtained from mice immunized with a mixture of toxoids from type C-strain Stockholm, type D-strain 1873 and type D-strain SA, 2 were specific for the light chain component of D-1873 and D-SA, while 3 were specific for light chain components of the 3 toxins. No antibodies recognizing exclusively each of the 2 different type D light chains could be obtained.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |