Immunisation with a synthetic prion protein-derived peptide prolongs survival times of mice orally exposed to the scrapie agent.

Title:

Immunisation with a synthetic prion protein-derived peptide prolongs survival times of mice orally exposed to the scrapie agent.

identifier:	1277823
description:	epitope description:PMIHFGNDWEDRYYRENMYRYPNQVYYRPV antigen name:Major prion protein host organism:Mus musculus NMRI
aggregation:	instance of dataset
availability:	available
primaryPublications:	14550926

study type:	b cell assays
subject species:	Mus musculus

fullName:	Anja Schwarz Oliver Krä tke Michael Burwinkel Constanze Riemer Julia Schultz Peter Henklein Theresa Bamme Michael Baier

method:	ELISA

name:	Immunisation with a synthetic prion protein-derived peptide prolongs survival times of mice orally exposed to the scrapie agent.
description:	Mice immunized with a recombinant PrP fragment (PrP 90-230) and subsequently infected by oral exposure to a 10% brain homogenate prepared from a terminally diseased scrapie-strain 139A-infected mouse, did not achieve significant survival times compared to controls. Epitope mapping studies were performed with sera from the mice immunized with the recombinant PrP fragment (PrP 90-230).

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.