| identifier: | 1277869 |
| description: |
epitope description:KRIKSSSVLNMRYKNDKYVDTSGYDSNININGDVYKYPTNKNQFGIYNDKLSEVNISQNDYIIYDNKYKNFSISFWVRIPNYDNKIVNVNNEYTIINCMRDNNSGWKVSLNHNEIIWTFEDNRGINQKLAFNYGNANGISDYINKWIFVTITNDRLGDSKLYINGNLIDQKSILNLGNIHVSDNILFKIVNCSYTRYIGIRYFNIFDKELDETEIQTLYSNEPNTNILKDFWGNYLLYDKEYYLLNVLKPNNFIDRRKDSTLSINNIRSTILLANRLYSGIKVKIQRVNNSSTNDNLVRKNDQVYINFVASKTHLFPLYADTATTNKEKTIKISSSGNRFNQVVVMNSVGNCTMNFKNNNGNNIGLLGFKADTVVASTWYYTHMRDHTNSNGCFWNFISEEHGWQEK
antigen name:Botulinum neurotoxin type E
host organism:Oryctolagus cuniculus New Zealand White
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
16177380 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1001122 |
| landingPage: |
http://www.iedb.org/assay/1277869 |
| type: |
Literature
|
| publicationVenue: |
Infect Immun
|
| dates: |
2005
|
| study type: | b cell assays |
| subject species: | Clostridium botulinum E Beluga |
| fullName: |
Michael R Baldwin
William H Tepp
Christina L Pier
Marite Bradshaw
Mengfei Ho
Brenda A Wilson
Robert B Fritz
Eric A Johnson
Joseph T Barbieri
|
| method: |
western blot
|
| name: |
Characterization of the antibody response to the receptor binding domain of botulinum neurotoxin serotypes A and E.
|
| description: |
BoNT/E HC domain is recognized by rabbit antisera raised to this domain in both WB and direct ELISA (titer 1/20000), while BoNT/A1 and A2 Hc domains are recognized in ELISA with titers of 1/1300.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |