Immunological Data Discovery Index
Immunological Data Discovery Index
| identifier: | 1278003 |
| description: |
epitope description:SYTNDKILILYFNKLYKKIKDNSILDMRYENNKFIDISGYGSNISINGDVYIYSTNRNQFGIYSSKPSEVNIAQNNDIIYNGRYQNFSISFWVRIPKYFNKVNLNNEYTIIDCIRNNNSGWKISLNYNKIIWTLQDTAGNNQKLVFNYTQMISISDYINKWIFVTITNNRLGNSRIYINGNLIDEKSISNLGDIHVSDNILFKIVGCNDTRYVGIRYFKVFDTELGKTEIETLYSDEPDPSILKDFWGNYLLYNKRYYLLNLLRTDKSITQNSNFLNINQQRGVYQKPNIFSNTRLYTGVEVIIRKNGSTDISNTDNFVRKNDLAYINVVDRDVEYRLYADISIAKPEKIIKLIRTSNSNNSLGQIIVMDSIGNNCTMNFQNNNGGNIGLLGFHSNNLVASSWYYNNIRKNTSSNGCFWSFISKEHGWQEN
antigen name:UniProt:D5VV58
host organism:Mus musculus BALB/c
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
10930684 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1001658 |
| landingPage: |
http://www.iedb.org/assay/1278003 |
| type: |
Literature
|
| publicationVenue: |
Vaccine
|
| dates: |
2000
|
| study type: | b cell assays |
| subject species: | Clostridium botulinum F NCTC 10281 |
| fullName: |
J L Holley
M Elmore
M Mauchline
N Minton
R W Titball
|
| method: |
in vivo assay
|
| name: |
Cloning, expression and evaluation of a recombinant sub-unit vaccine against Clostridium botulinum type F toxin.
|
| description: |
This fragment is expressed in vitro from a synthetic gene constructed to encode the residues 848-1278 (binding domain) of the BoNT/F toxin of strain NCTC 10281. The nucleotide sequence of the gene was modified to include an initiation methionine and to have optimal codon usage in E.coli.
Even in the absence of a measurable response by ELISA towards whole type F toxin, mice immunized 2 or 3 times with different doses (1.9 to 1000 ng) of the Hc fragment show dose and number of immunization dependance in the protection to subsequent (14 days after the last immunization) challenge with the toxin. As little as 3 doses of 3.9ng or 2 doses of 31.2ng were sufficient to produce a 100% survival rate.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |
