| identifier: | 1278143 |
| description: |
epitope description:PFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPNRVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFTGLFEFYKLLCVRGIITSKTKSLDKGYNK
antigen name:Botulinum neurotoxin type A (UniProt:A5HZZ9)
host organism:Mus musculus ICR
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
11425742 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/900 |
| landingPage: |
http://www.iedb.org/assay/1278143 |
| type: |
Literature
|
| publicationVenue: |
Appl Environ Microbiol
|
| dates: |
2001
|
| study type: | b cell assays |
| subject species: | Clostridium botulinum |
| fullName: |
H C Wu
C T Yeh
Y L Huang
L J Tarn
C C Lung
|
| method: |
ELISA
|
| name: |
Characterization of neutralizing antibodies and identification of neutralizing epitope mimics on the Clostridium botulinum neurotoxin type A.
|
| description: |
In order to evaluate the immunogenicity of a phage-displayed mimotope peptide, peptide-expressing phage particles were injected into ICR mice and the response against the BoNT/A toxin was analyzed in ELISA. All the mice generated a specific response. The specificity of the antibody induced by the peptide was further demonstrated by immunoblotting analysis to be directed to the light chain of BoNT/A, as was the parental mAb (BT57-1) that selected the immunogenic peptide.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |