Hepatitis E virus: identification of type-common epitopes. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

Hepatitis E virus: identification of type-common epitopes.

Dataset

identifier:	1311988
description:	epitope description:TFDYPGRAHTFDDFCPECRALGLQGCAFQSTVAELQRLKVKV antigen name:Capsid protein host organism:Macaca fascicularis antibody name:C-130
aggregation:	instance of dataset
availability:	available
primaryPublications:	1717709

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1001507
landingPage:	http://www.iedb.org/assay/1311988

Publication

type:	Literature
publicationVenue:	J Virol
dates:	1991

Dimension

study type:	b cell assays
subject species:	Hepatitis E virus (strain Mexico)

Person

fullName:	P O Yarbough A W Tam K E Fry K Krawczynski K A McCaustland D W Bradley G R Reyes

Data Type

method:	phage display

Study

name:	Hepatitis E virus: identification of type-common epitopes.
description:	The sequence is derived from a region of HEV(M) ORF2. Immunoscreening in a plaque assay format showed that the epitope expressed from a lambda gt11 expression vector was recognized by acute- and convalescent-phase sera from cynomoglgus macaques inoculated with human stool samples infected with HEV strain Burma.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.