| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1002103 |
| landingPage: |
http://www.iedb.org/assay/1324942 |
| type: |
Literature
|
| publicationVenue: |
Virology
|
| dates: |
1999
|
| study type: | b cell assays |
| subject species: | Hepatitis C virus |
| fullName: |
Y H Zhou
M Moriyama
M Esumi
|
| method: |
antigen inhibition
|
| name: |
Multiple sequence-reactive antibodies induced by a single peptide immunization with hypervariable region 1 of hepatitis C virus.
|
| description: |
Pre-incubation of the epitope with the immune sera obtained from animals immunized with peptide HVR1-7 (HTRVTGGVQGHVTSTLTSLFRPGASQKIQLV) inhibited the binding of anti-HVR1-7 to the HVR1-7 peptide.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |