Elongating modified conserved peptides eliminates their immunogenicity and protective efficacy against P. falciparum malaria.

Title:

Elongating modified conserved peptides eliminates their immunogenicity and protective efficacy against P. falciparum malaria.

identifier:	1340188
description:	epitope description:QIPYNLKIRANELDVLKKLV antigen name:Merozoite surface protein 1 host organism:Aotus nancymaae
aggregation:	instance of dataset
availability:	available
primaryPublications:	15890273

study type:	b cell assays
subject species:	Plasmodium falciparum

fullName:	Fabiola Espejo Adriana Bermú dez Magnolia Vanegas Zuly Rivera Elizabeth Torres Luz Mary Salazar Manuel Elkin Patarroyo

method:	ELISA

name:	Elongating modified conserved peptides eliminates their immunogenicity and protective efficacy against P. falciparum malaria.
description:	Reactivity towards this peptide, previously shown to be of poor immunogenicity by itself, is not enhanced by immunization with a polymerized longer peptide, QIPYNLKIRANELDVLKKLVFGYRKPLDNIKDNVGKMEDY. These data corroborate the complete absence of this peptide immunogenicity, independently of how it is presented to the immune system, alone or as a component of an elongated molecule.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.