| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1002766 |
| landingPage: |
http://www.iedb.org/assay/1340325 |
| type: |
Literature
|
| publicationVenue: |
J Struct Biol
|
| dates: |
2005
|
| study type: | b cell assays |
| subject species: | Plasmodium falciparum |
| fullName: |
Fabiola Espejo
Adriana Bermú
dez
Magnolia Vanegas
Zuly Rivera
Elizabeth Torres
Luz Mary Salazar
Manuel Elkin Patarroyo
|
| method: |
ELISA
|
| name: |
Elongating modified conserved peptides eliminates their immunogenicity and protective efficacy against P. falciparum malaria.
|
| description: |
Reactivity towards this peptide, previously shown to be of poor immunogenicity by itself, is not enhanced by immunization with a polymerized longer peptide, QIPYNLKIRANELDVLKKLVFGYRKPLDNIKDNVGKMEDY. These data corroborate the complete absence of this peptide immunogenicity, independently of how it is presented to the immune system, alone or as a component of an elongated molecule.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |