| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1002766 |
| landingPage: |
http://www.iedb.org/assay/1340337 |
| type: |
Literature
|
| publicationVenue: |
J Struct Biol
|
| dates: |
2005
|
| study type: | b cell assays |
| subject species: | Plasmodium falciparum |
| fullName: |
Fabiola Espejo
Adriana Bermú
dez
Magnolia Vanegas
Zuly Rivera
Elizabeth Torres
Luz Mary Salazar
Manuel Elkin Patarroyo
|
| method: |
ELISA
|
| name: |
Elongating modified conserved peptides eliminates their immunogenicity and protective efficacy against P. falciparum malaria.
|
| description: |
After immunization with a polymerized longer peptide (FTYIENKLDILNNSKPNKRWKSYGTPDNIDKNMSLIHKHN), there is significant reactivity towards the immunizing peptide and to this epitope, which represents its N terminal end, but not towards the C-terminal end, which has the red blood cell binding activity. The response obtained failed to provide protection against experimental challenge with the parasite.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |