A novel microencapsulated peptide vaccine against hepatitis B. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

A novel microencapsulated peptide vaccine against hepatitis B.

Dataset

identifier:	1350267
description:	epitope description:CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWAS antigen name:Large envelope protein host organism:Mus musculus BALB/c
aggregation:	instance of dataset
availability:	available
primaryPublications:	11312028

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1003221
landingPage:	http://www.iedb.org/assay/1350267

Publication

type:	Literature
publicationVenue:	Vaccine
dates:	2001

Dimension

study type:	b cell assays
subject species:	Hepatitis B virus

Person

fullName:	J S Moynihan D H Jones G H Farrar C R Howard

Data Type

method:	ELISA

Study

name:	A novel microencapsulated peptide vaccine against hepatitis B.
description:	Similar antibody responses to the epitope were observed after immunization with the epitope encapsulated in polyactide co-glycolide microspheres (PLG) at two ratios (50:50 or 75:25) or in Freund's complete adjuvant. The primary IgG subclass was IgG1 with lesser amounts of IgG2a and low levels of IgG2b and IgG3. The epitope also blocked binding of anti-epitope sera to the epitope and to HBVsAg.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.