Epitope mapping and immunological characterization of a major allergen TBa in tartary buckwheat. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

Epitope mapping and immunological characterization of a major allergen TBa in tartary buckwheat.

Dataset

identifier:	1790173
description:	epitope description:RAGRINTVNSNNLPILEFLQLSAQHVVLYKNAIIGPRWNLN antigen name:Fagopyrum tataricum (Kangra buckwheat) protein host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	20431913

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1020895
landingPage:	http://www.iedb.org/assay/1790173

Publication

type:	Literature
publicationVenue:	Biotechnol Lett
dates:	2010

Dimension

study type:	b cell assays
subject species:	Fagopyrum tataricum

Person

fullName:	Xiaoxia Ren Xin Zhang Yuying Li Zhuanhua Wang

Data Type

method:	ELISA

Study

name:	Epitope mapping and immunological characterization of a major allergen TBa in tartary buckwheat.
description:	Both patient's serum samples bound the epitope. Mutation analysis indicated that leucines at positions 16, 21 and 28 were important for binding of the antibodies to the epitope.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.