Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins.

Title:

Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins.

identifier:	1770506
description:	epitope description:RIQDLEKYVEDTKIDLWSYNAELLVALENQ antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:12D1
aggregation:	instance of dataset
availability:	available
primaryPublications:	20195520

study type:	b cell assays
subject species:	Influenza A virus (A/Hong Kong/1/1968(H3N2))

fullName:	Taia T Wang Gene S Tan Rong Hai Natalie Pica Erin Petersen Thomas M Moran Peter Palese

method:	ELISA

name:	Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins.
description:	The epitope was deduced. All the other tested human Flu A H3 viruses (A/Hong Kong/1/1968, A/Beijing/47/1992, A/Wisconsin/67/2005, A/Brisbane/10/2007 and A/New York/2008) were also recognized by the epitope-specific mAb, while H1, H2 and equine H3 viruses were not recognized

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.