Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins.

Title:

Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins.

identifier:	1774274
description:	epitope description:RIQDLEKYVEDTKIDLWSYNAELLVALENQ antigen name:Hemagglutinin host organism:Mus musculus BALB/c antibody name:12D1
aggregation:	instance of dataset
availability:	available
primaryPublications:	20195520

study type:	b cell assays
subject species:	Influenza A virus (A/Hong Kong/1/1968(H3N2))

fullName:	Taia T Wang Gene S Tan Rong Hai Natalie Pica Erin Petersen Thomas M Moran Peter Palese

method:	western blot

name:	Broadly protective monoclonal antibodies against H3 influenza viruses following sequential immunization with different hemagglutinins.
description:	The epitope was deduced. By analysis of the truncation mutants, it was determined that epitope-specific mAb 12D1 binding is dependent on contacts with amino acids in the HA2 76–106 region.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.