Epitope and functional specificity of monoclonal antibodies to mouse interferon-gamma: the synthetic peptide approach.

Title:

Epitope and functional specificity of monoclonal antibodies to mouse interferon-gamma: the synthetic peptide approach.

identifier:	1784721
description:	epitope description:CYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQ antigen name:Interferon gamma host organism:Oryctolagus cuniculus New Zealand White
aggregation:	instance of dataset
availability:	available
primaryPublications:	2420886

study type:	b cell assays
subject species:	Mus musculus

fullName:	J K Russell M P Hayes J M Carter B A Torres B M Dunn S W Russell H M Johnson

method:	antigen inhibition

name:	Epitope and functional specificity of monoclonal antibodies to mouse interferon-gamma: the synthetic peptide approach.
description:	The epitope sequence was cited from reference Gray et al., Proc Natl Acad Sci U S A. 1983 Oct 80(19):5842-6 [PMID: 6310596]. The epitope inhibited the binding of epitope-specific antisera to IFN-g protein in a competitive RIA. The epitope-specific antisera also reacted with the epitope in a direct RIA.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.