Epitope and functional specificity of monoclonal antibodies to mouse interferon-gamma: the synthetic peptide approach.

Title:

Epitope and functional specificity of monoclonal antibodies to mouse interferon-gamma: the synthetic peptide approach.

identifier:	1784729
description:	epitope description:CYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQ antigen name:Interferon gamma host organism:Cricetulus migratorius antibody name:mAbs 5.74.1, 5.102.12, 5.52.1, 4.6.27
aggregation:	instance of dataset
availability:	available
primaryPublications:	2420886

study type:	b cell assays
subject species:	Mus musculus

fullName:	J K Russell M P Hayes J M Carter B A Torres B M Dunn S W Russell H M Johnson

method:	biological activity

name:	Epitope and functional specificity of monoclonal antibodies to mouse interferon-gamma: the synthetic peptide approach.
description:	The epitope sequence was cited from reference Gray et al., Proc Natl Acad Sci U S A. 1983 Oct 80(19):5842-6 [PMID: 6310596]. The epitope-specific mAbs inhibited the antiviral activity and macrophage priming activity of IFN-g protein. Only two of four epitope-specific mAbs (5.102.12 and 5.74.1) inhibited the binding of IFN-g to mouse L929 cells. The other two mAbs (5.52.1 and 4.6.27) caused an enhanced binding of IFN-g to L929 cells.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.