| identifier: | 1473984 |
| description: |
epitope description:FVMKREPLRFRDITVEGNENAYIKNGKLHLSLMDPSTLSLVTKADGKID
antigen name:Other Dermatophagoides farinae (American house dust mite) protein
host organism:Homo sapiens
antibody name:pooled patient sera
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
7510559 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1005611 |
| landingPage: |
http://www.iedb.org/assay/1473984 |
| type: |
Literature
|
| publicationVenue: |
Int Arch Allergy Immunol
|
| dates: |
1994
|
| study type: | b cell assays |
| subject species: | Dermatophagoides farinae |
| fullName: |
K Ono
Y Hidaka
Y Shimonishi
M Yamashita
S Shigeta
Y Murooka
S Oka
|
| method: |
western blot
|
| name: |
Structure of IgE epitopes on a new 39-kD allergen molecule from the house dust mite, Dermatophagoides farinae.
|
| description: |
The sequence is from the reference: Aki et al. (1994) Int. Arch. Allergy Immunol. 103, 349-356. [PMID: 7510558]
Pooled IgE sera from 10 mite-allergic patients did not react with the epitope.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |