IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

Title:

IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.

identifier:	1473238
description:	epitope description:LAQPQRYCRHYWTIKDLDAFRHYDGRTIIQRDNGYQPNYHAVNIVGYSNAQGVDYWI antigen name:Der p 1 host organism:Oryctolagus cuniculus antibody name:hyperimmune rabbit anti-Der p I serum
aggregation:	instance of dataset
availability:	available
primaryPublications:	1940366

study type:	b cell assays
subject species:	Dermatophagoides pteronyssinus

fullName:	W K Greene J G Cyster K Y Chua R M O'Brien W R Thomas

method:	radio immuno assay (RIA)

name:	IgE and IgG binding of peptides expressed from fragments of cDNA encoding the major house dust mite allergen Der p I.
description:	The sequence is from the reference cited: Chua et al. (1988) J Exp Med 167: 175-182. [PMID: 3335830] An internal source ID is assigned, because the sequence provided in the reference differs from those found by BLAST at residues 134-143.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.