Effective synthetic peptide vaccine for foot-and-mouth disease in swine. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

Effective synthetic peptide vaccine for foot-and-mouth disease in swine.

Dataset

identifier:	1474391
description:	epitope description:VYNGNCKYGENAVTNVRGDLQVLAQKAARCLPTSFNYGAIK host organism:Cavia porcellus Duncan-Hartley antibody name:Guinea pig sera
aggregation:	instance of dataset
availability:	available
primaryPublications:	12057619

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1006581
landingPage:	http://www.iedb.org/assay/1474391

Publication

type:	Literature
publicationVenue:	Vaccine
dates:	2002

Dimension

study type:	b cell assays
subject species:

Person

fullName:	Chang Yi Wang Tseng Yuan Chang Alan M Walfield John Ye Ming Shen Shih Ping Chen Ming Chang Li Yeou Liang Lin Ming Hwa Jong Ping Cheng Yang Nancy Chyr Ed Kramer Fred Brown

Data Type

method:	biological activity

Study

name:	Effective synthetic peptide vaccine for foot-and-mouth disease in swine.
description:	This epitope is a consensus sequence from six serotype O strains for amino acids 129-169, and is most similar to O TWN/2/99, from which it differs by three amino acids. The consensus sequence also includes two cystines that permit cyclization. Sera from guinea pigs immunized with the O consensus peptide linked to a mixture of two measles-derived T-helper epitopes were able to neutralize virus from another serotype, Asia 1.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.