B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

Title:

B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.

identifier:	1476358
description:	epitope description:TKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGA antigen name:Phl p 1 host organism:Homo sapiens antibody name:patient sera
aggregation:	instance of dataset
availability:	available
primaryPublications:	10428753

study type:	b cell assays
subject species:	Phleum pratense

fullName:	W R Sperr P Valent L Vangelista D Kraft R Valenta

method:	western blot

name:	B cell epitopes of the major timothy grass pollen allergen, phl p 1, revealed by gene fragmentation as candidates for immunotherapy.
description:	Serum IgG4 from allergic patients who had received grass pollen immunotherapy reacted with the epitope in a screen of a randomly fragmented Phl p I cDNA expression library.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.