Immunological Data Discovery Index
Immunological Data Discovery Index
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1006414 |
| landingPage: |
http://www.iedb.org/assay/1478012 |
| type: |
Literature
|
| publicationVenue: |
J Virol
|
| dates: |
1994
|
| study type: | b cell assays |
| subject species: | Foot-and-mouth disease virus (strain O1) (O1BFS) |
| fullName: |
E Rieder
B Baxt
J Lubroth
P W Mason
|
| method: |
biological activity
|
| name: |
Vaccines prepared from chimeras of foot-and-mouth disease virus (FMDV) induce neutralizing antibodies and protective immunity to multiple serotypes of FMDV.
|
| description: |
Numbers differ because the paper uses numbering from the mature VP1 protein which is processed from the larger polyprotein that is found in the database.
Monoclonal antibody raised against 12S particles containing VP1, VP2 and VP3 of FMDV type O neutralized the O epitope as presented by recombinant FMDV strain A12. The FMDV O1 BFS strain epitope described was substituted for aa 857-881 (TNKYSASGSGVRGDFGSLAPRVARQ) in the VP1 region of the polyprotein of the A12 virus. Monoclonal antibody 12FE9 was previously shown in the reference Stave et al. (1986) J Gen Virol 67:2083 [PMID: 2428926] to bind to the synthetic peptide SRNAVPNVRGDLQVLAQKVARTLPTSFNYGAIKATR corresponding to aa 861-896 in the VP1 region of FMDV strain O1 Campos. The region of overlap for mAb interaction would likely limit the epitope to aa 861-882 of the O1 VP1 polyprotein. . Note that there is one amino acid difference between the O1 BFS sequence and the original O1 Campos sequence, an exchange of L for V at position 12 of the epitope.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |
