Immunological Data Discovery Index
Immunological Data Discovery Index
| identifier: | 1479346 |
| description: |
epitope description:AAAGFMVLQDINCFRPHGVSAAQEKISFGKSSQCREAVGT
antigen name:Glycoprotein 4
host organism:Mus musculus
antibody name:122.1, 122.20, 122.59, 122.68, 122.70, 126.1, 126.7,122.29, 122.30, 122.66, 122.71, 130.7, 138.28, 122.12
|
| aggregation: |
instance of dataset
|
| availability: |
available
|
| primaryPublications: |
9223499 |
| authorizations: |
registration not required
|
| accessURL: |
http://www.iedb.org/reference/1009733 |
| landingPage: |
http://www.iedb.org/assay/1479346 |
| type: |
Literature
|
| publicationVenue: |
J Virol
|
| dates: |
1997
|
| study type: | b cell assays |
| subject species: | Lelystad virus |
| fullName: |
J J Meulenberg
A P van Nieuwstadt
A van Essen-Zandbergen
J P Langeveld
|
| method: |
biological activity
|
| name: |
Posttranslational processing and identification of a neutralization domain of the GP4 protein encoded by ORF4 of Lelystad virus.
|
| description: |
The epitope-specific mAbs reduced plaque count from LV-infected cells, and also neutralized a Dutch isolate (NL1) and an English isolate (NY2), which share the epitope sequence. The mAbs did not neutralize the US isolate VR2332, a Danish isolate (DEN), two Spanish isolates (SPA 1 and SPA2), a French isolate (FRA), or a Luxemburg isolate (LUX), all of which differ at residues in the epitope. The mAbs also were positive in an indirect immunoperoxidase assay of lung aveolar macrophages infected with LV.
|
| name: |
iedb
|
| homePage: |
http://www.iedb.org |
