A DNA fusion vaccine induces bactericidal antibodies to a peptide epitope from the PorA porin of Neisseria meningitidis.

Title:

A DNA fusion vaccine induces bactericidal antibodies to a peptide epitope from the PorA porin of Neisseria meningitidis.

identifier:	1480539
description:	epitope description:PIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGS antigen name:Major outer membrane protein P.IA host organism:Mus musculus BALB/c
aggregation:	instance of dataset
availability:	available
primaryPublications:	17967859

study type:	b cell assays
subject species:	Neisseria meningitidis MC58

fullName:	Delin Zhu Jeannette N Williams Jason Rice Freda K Stevenson John E Heckels Myron Christodoulides

method:	biological activity

name:	A DNA fusion vaccine induces bactericidal antibodies to a peptide epitope from the PorA porin of Neisseria meningitidis.
description:	This epitope sequence is derived from cited reference by R. van der Voort, et al (Infect Immun. 1996 Jul 64(7):2745-51. [PMID: 8698504]). Antibodies mediated bactericidal killing was detected for bacteria of strain MC58 (serotype P1.7,16b), but not with strains H44/76 (P1.7,16), MC50 (P1.21,16), MC106 (P1.7,9), nor MC168 (P1.5,2).

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.