Ability of linear and cyclic peptides of neutralization antigenic site 1 of poliovirus type 1 to induce virus cross-reactive and neutralizing antibodies.

Title:

Ability of linear and cyclic peptides of neutralization antigenic site 1 of poliovirus type 1 to induce virus cross-reactive and neutralizing antibodies.

Dataset

identifier:	1483107
description:	epitope description:ARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTV antigen name:Genome polyprotein host organism:Oryctolagus cuniculus New Zealand White
aggregation:	instance of dataset
availability:	available
primaryPublications:	7535942

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1010890
landingPage:	http://www.iedb.org/assay/1483107

Publication

type:	Literature
publicationVenue:	Res Virol
dates:	1994

Dimension

study type:	b cell assays
subject species:	Human poliovirus 1 Mahoney

Person

fullName:	S van der Werf J P Briand S Plaué J Burckard M Girard M H Van Regenmortel

Data Type

method:	biological activity

Study

name:	Ability of linear and cyclic peptides of neutralization antigenic site 1 of poliovirus type 1 to induce virus cross-reactive and neutralizing antibodies.
description:	The epitope was synthesized with an N-terminal addition of CG and a C-terminal addition of GC. Sera from rabbits immunized with the free form of the epitope neutralized and immunoprecipitated the virus.The sera also reacted with heat-treated virus (C-particles) by immunoprecipitation and ELISA.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Related Publications

Feedback?