Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

Title:

Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.

identifier:	1482317
description:	epitope description:YSRNAVPNLRGDLQVLAQKVARTLPTSFNY antigen name:Polyprotein host organism:Cavia porcellus Duncan-Hartley antibody name:anti-peptide
aggregation:	instance of dataset
availability:	available
primaryPublications:	2155177

study type:	b cell assays
subject species:	Foot-and-mouth disease virus (strain O1) (O1BFS)

fullName:	M J Francis G Z Hastings B E Clarke A L Brown C R Beddell D J Rowlands F Brown

method:	biological activity

name:	Neutralizing antibodies to all seven serotypes of foot-and-mouth disease virus elicited by synthetic peptides.
description:	The epitope was synthesized with a C-terminal Cys residue. Antiserum against the VP1 (136-165) peptide from FMDV strain O1 BFS cross-neutralized the type SAT 2 virus, but did not cross-neutralize serotypes A22Iraq, C3 Indaial, SAT1 Bot 1/68, or A12.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.