Epitope mapping of HTLV envelope seroreactivity in LGL leukaemia. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

Epitope mapping of HTLV envelope seroreactivity in LGL leukaemia.

Dataset

identifier:	1483331
description:	epitope description:IVKNHQNILRVAQYAAQNRRGLDLLFWEQGGLCKAIQEQCCFLN antigen name:Envelope glycoprotein gp63 host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	9609528

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1006403
landingPage:	http://www.iedb.org/assay/1483331

Publication

type:	Literature
publicationVenue:	Br J Haematol
dates:	1998

Dimension

study type:	b cell assays
subject species:	Human T-lymphotropic virus 2

Person

fullName:	T P Loughran Jr K G Hadlock R Perzova T C Gentile Q Yang S K Foung B J Poiesz

Data Type

method:	western blot

Study

name:	Epitope mapping of HTLV envelope seroreactivity in LGL leukaemia.
description:	A patient infected with HTLV-2 with LGL leukemia reacted with the epitope.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.