Epitope analysis of an immunodominant domain on the P1 protein of Haemophilus influenzae type b using synthetic peptides and anti-idiotypic antibodies.

Title:

Epitope analysis of an immunodominant domain on the P1 protein of Haemophilus influenzae type b using synthetic peptides and anti-idiotypic antibodies.

Dataset

identifier:	1486676
description:	epitope description:FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF antigen name:Outer membrane protein P1 host organism:Mus musculus antibody name:P1.1, P1.6, P1.7, P1.2, P1.3, P1.4, P1.5
aggregation:	instance of dataset
availability:	available
primaryPublications:	1522798

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1011075
landingPage:	http://www.iedb.org/assay/1486676

Publication

type:	Literature
publicationVenue:	Microb Pathog
dates:	1992

Dimension

study type:	b cell assays
subject species:	Haemophilus influenzae Serotype B

Person

fullName:	C Proulx J Hamel P Chong D Martin B R Brodeur

Data Type

method:	ELISA

Study

name:	Epitope analysis of an immunodominant domain on the P1 protein of Haemophilus influenzae type b using synthetic peptides and anti-idiotypic antibodies.
description:	The sequence represents that of strain MinnA. The epitope-specific mAbs P1.1, P1.2, P1.3, P.14, P1.5, P1.6 and P1.7 recognized P1 protein from Haemophilus influenza strains MinnA or 1613. Group B MAbs P1.1 and P1.7 are IgG1,k isotypes while P1.6 is IgG2b, k. Group A MAbs P1.4 and P1.5 are IgG4, k isotypes while P1.2 is IgG2b, k, and P1.3 is IgG1, k.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.

Related Publications

Feedback?