Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

Title:

Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.

identifier:	1487058
description:	epitope description:NQFLTSDDFQSPSAMPQFDVTPEMDIPGQV antigen name:Genome polyprotein host organism:Mus musculus BALB/c antibody name:1H2, 1H7, 3D7, 5D6, 3C1, 4A9
aggregation:	instance of dataset
availability:	available
primaryPublications:	12029154

study type:	b cell assays
subject species:	Swine vesicular disease virus SPA/1/93

fullName:	Belé n Borrego Juan Antonio Garcí a-Ranea Alastair Douglas Emiliana Brocchi

method:	ELISA

name:	Mapping of linear epitopes on the capsid proteins of swine vesicular disease virus using monoclonal antibodies.
description:	The epitope sequence is from the reference cited: Jimenez-Clavero et al. (2000) Virology 270: 76-83 [PMID: 10772981]. The epitope was deduced. The epitope sequence was deduced through study of overlapping peptides. The mAbs also reacted with peptide VP3 (201-220) (PADAQSDCKILCFVSACNDF). Both peptides contain the motif DxQSxxxxxxF. The authors conclude that recognition of both peptides by the mAbs is due to cross-reaction since the peptides are distant from one another in the 3D model of the molecule.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.