Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

Title:

Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.

identifier:	1491569
description:	epitope description:ADEVQRMMAEIDTDGDGFIDFNEFISFCNANPGLMKDVAKVF antigen name:Phl p 7 host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	15100313

study type:	b cell assays
subject species:	Phleum pratense

fullName:	Kerstin Westritschnig Margarete Focke Petra Verdino Walter Goessler Walter Keller Anna Twardosz Adriano Mari Friedrich Horak Ursula Wiedermann Arnulf Hartl Josef Thalhamer Wolfgang R Sperr Peter Valent Rudolf Valenta

method:	in vivo skin test

name:	Generation of an allergy vaccine by disruption of the three-dimensional structure of the cross-reactive calcium-binding allergen, Phl p 7.
description:	The epitope sequence is from the reference cited: Niederberger et al. (1999) FASEB J. 13: 843-856 [PMID: 10224228]. The epitope did not induce an immediate type skin reaction in Phl p 7-allergic patients in a skin-prick test.

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.