Identification of surface-exposed B-cell epitopes recognized by Haemophilus influenzae type b P1-specific monoclonal antibodies.

Title:

Identification of surface-exposed B-cell epitopes recognized by Haemophilus influenzae type b P1-specific monoclonal antibodies.

identifier:	1496715
description:	epitope description:VKTIGDKRTLTLNTTANYT antigen name:Outer membrane protein P1 host organism:Mus musculus BALB/c antibody name:3E12
aggregation:	instance of dataset
availability:	available
primaryPublications:	7682997

study type:	b cell assays
subject species:	Haemophilus influenzae MinnA

fullName:	H Panezutti O James E J Hansen Y Choi R E Harkness M H Klein P Chong

method:	antigen inhibition

name:	Identification of surface-exposed B-cell epitopes recognized by Haemophilus influenzae type b P1-specific monoclonal antibodies.
description:	The epitope inhibited binding of epitope-specific mAb(s) to an epitope-containing peptide (FKEVKTIGDKRTLTLNTTANYTSQAHANLYGLNLNYSF).

name:	iedb
homePage:	http://www.iedb.org

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.