IgE binding structures of the major house dust mite allergen Der p I. | ImmuneData Discovery Index

Immunological Data Discovery Index

Immunological Data Discovery Index

Title:

IgE binding structures of the major house dust mite allergen Der p I.

Dataset

identifier:	1496859
description:	epitope description:TNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSCWAFSGVAATESAYLAHRNQSLD antigen name:Der p 1 host organism:Homo sapiens
aggregation:	instance of dataset
availability:	available
primaryPublications:	1371823

Access

authorizations:	registration not required
accessURL:	http://www.iedb.org/reference/1005760
landingPage:	http://www.iedb.org/assay/1496859

Publication

type:	Literature
publicationVenue:	Mol Immunol
dates:	1992

Dimension

study type:	b cell assays
subject species:	Dermatophagoides pteronyssinus

Person

fullName:	W K Greene W R Thomas

Data Type

method:	antigen inhibition

Study

name:	IgE binding structures of the major house dust mite allergen Der p I.
description:	The sequence is from the reference cited: Chua et al. (1988) J Exp Med 167: 175-182 [PMID: 3335830] and Dilworth et al. (1991) Clin Exp Allergy 21: 25-32 [PMID: 2021874]. The epitope absorbed the IgE reactivity from serum of a highly allergic patient to the epitope. Peptides 1-116 and 15-94 also absorbed IgE reactivity to the epitope. Absorption with the epitope reduced reactivity to peptide 15-94, but did not absorb reactivity to peptides 1-116, 34-80, 53-99, or non-overlapping Der p I peptides. The epitope was inferred to be residues 15-33 because peptide 15-94 removed reactivity, but peptide 34-80 did not.

Data Repository

name:	iedb
homePage:	http://www.iedb.org

Feedback?

If you are having problems using our tools, or if you would just like to send us some feedback, please post your questions on Feedback.